Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501856

ADP-Dependent Glucokinase (ADPGK) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610017G09Rik, ADP-GK, Adp-gk, C77577, RGD1306103, ADPGK
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501856
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the middle region of human ADPGK
Sequence GIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGN SLQAISGMIV
Predicted Reactivity Horse : 100%, Human : 100%, Dog : 84%, Pig : 84%, Mouse : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against ADPGK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ADPGK
Background ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions. ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).
Molecular Weight 54kDa
Gene ID 83440
NCBI Accession NP_112574, NM_031284
UniProt Q9BRR6
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ADPGK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "ADP-Dependent Glucokinase (ADPGK)", type "Antibodies"
Hosts (19), (4)
Reactivities (23), (13), (11), (3), (3)
Applications (23), (11), (3), (2), (1)
Epitopes (5), (2), (2), (2)
Beacon