Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) antibody

Antigen

Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH)
Synonyms
G3PD, GAPD, MGC88685, Gapd, MGC102544, MGC102546, MGC103190, MGC103191, MGC105239, GA3PDH, GADPH, GAP, GAPDH, GAPDH II, GAPDH2, Gapdh-2, Gapdh13F, DmelCG8893, CG8893, BEST:GH12586, GAPDH I, GAPDH-1, G ... show more
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501932
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name GAPDH
Gene ID GAPDH
UniProt P04406
Immunogen The immunogen for anti-GAPDH antibody: synthetic peptide directed towards the middle region of human GAPDH
Sequence KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKI ISNASCTTNC
Cross-Reactivity Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-GAPDH antibody concentration is 1 mg/ml.
Description GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 335 amino acids
Molecular Weight 36kDa
Synonyms G3PD, GAPD, MGC88685, Gapd, MGC102544, MGC102546, MGC103190, MGC103191, MGC105239, GA3PDH, GADPH, GAP, GAPDH, GAPDH II, GAPDH2, Gapdh-2, Gapdh13F, DmelCG8893, CG8893, BEST:GH12586, GAPDH I, GAPDH-1, Gapdh43E, gh12586, DmelCG12055, CG12055, MGC127711, gapd, cb609, wu:fb33a10, KNC-NDS6, g3pd, MGC89215, G3PDH, DKFZp468E2417, MGC53986, GAPC-2, GAPC2, GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2, glyceraldehyde-3-phosphate dehydrogenase C2, T6J4.17, T6J4_17

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer, Metabolism, Alzheimer's Disease, Enzymes
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Rinne, Clements, Lamme et al.: "A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes." in: Human molecular genetics, Vol. 17, Issue 13, pp. 1968-77, 2008 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH)", type "Antibodies"
Hosts Rabbit (184), Mouse (105), Goat (28), Sheep (16), Chicken (8)
Reactivities Human (238), Mouse (Murine) (146), Rat (Rattus) (145), Rabbit (35), Pig (Porcine) (30), Cow (Bovine) (21), Dog (Canine) (21), Chicken (13), Monkey (13), Cat (Feline) (8), Goat (8), Fish (7), Mammalian (7), Yeast (Saccharomyces cerevisiae) (6), Hamster (5), Bird (Avian) (4), Fruit Fly (Drosophila melanogaster) (4), Escherichia coli (E. coli) (3), Insect (3), Macaque (3), Xenopus laevis (3), Yeast (Saccharomyces Cerevisiae) (2), Amphibian (1), Bacteria (1), Chimpanzee (1), General (1), Saccharomyces cerevisiae (S. cerevisiae) (1), Sheep (Ovine) (1)
Applications Western Blotting (WB) (256), ELISA (151), Immunofluorescence (IF) (148), Immunocytochemistry (ICC) (46), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (46), Immunohistochemistry (IHC) (42), Immunoprecipitation (IP) (30), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (12), Immunohistochemistry (Frozen Sections) (IHC (fro)) (8), Dot Blot (DB) (6), Immunodiffusion (ID) (6), Radioimmunoassay (RIA) (5), Immunoelectron Microscopy (IEM) (4), Dot Blot (Dot) (3), Flow Cytometry (FACS) (3), Immunohistochemistry (Fixed) (IHC (fx)) (2), Fluorescence Microscopy (FM) (1), Immunostaining (ISt) (1), Purification (Purif) (1)
Conjugates Biotin (17), HRP (11), FITC (6), Alexa Fluor 350 (5), Alexa Fluor 488 (5), Alexa Fluor 555 (5), Alexa Fluor 647 (5), PE,Cy5.5 (5), Cy3 (4), Cy5 (4), Cy5.5 (4), Cy7 (4), Gold (4), PE (4), PE,Cy3 (4), PE,Cy5 (4), PE,Cy7 (4)
Epitopes C-Term (32), N-Term (16), Internal Region (8), AA 73-87 (2), AA 1-150 (1), AA 1-154 (1), AA 1-335 (1), AA 150-200 (1), AA 200-250 (1), AA 250-300 (1), AA 51-290 (1), C-Term, Arg248 (1), N-Term,AA 30-44 (1)