Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501955

Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CSFT64, cstF-64, CstF-64, CSTF2, cstf-64, fb11e07, zgc:56346, zgc:77730, wu:fb11e07
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501955
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CSTF2 antibody: synthetic peptide directed towards the N terminal of human CSTF2
Sequence VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSM NQQNPQAPQA
Predicted Reactivity Human : 100%, Rabbit : 100%, Guinea pig : 85%, Horse : 85%, Mouse : 85%, Rat : 85%, Bovine : 84%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against CSTF2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CSTF2
Background CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.
Molecular Weight 61kDa
Gene ID 1478
NCBI Accession NP_001316, NM_001325
UniProt P33240
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CSTF2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2)", type "Antibodies"
Hosts (35), (5), (1)
Reactivities (38), (24), (12), (12), (12), (1)
Applications (31), (18), (10), (7), (6), (4), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (5), (2), (1), (1), (1), (1), (1)
Beacon