Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Fibulin 3 (FBLN3) antibody

Antigen

Fibulin 3 (FBLN3)

Synonyms DHRD, DRAD, FBNL, MLVT, MTLV, S1-5, FBLN3, FLJ35535, MGC111353, MGC37612, T16
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502115
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Fibulin-3
Gene ID EFEMP1
UniProt Q12805
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1
Sequence NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVS SIGTFRTSSV
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-EFEMP1 antibody concentration is 1 mg/ml.
Description EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
Characteristics Antigen Size: 493 amino acids
Molecular Weight 53kDa

Application Details

Application Notes WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Weedon, Lango, Lindgren et al.: "Genome-wide association analysis identifies 20 loci that influence adult height." in: Nature genetics, Vol. 40, Issue 5, pp. 575-83, 2008 (PubMed).

Alternatives

Alternatives for antigen "Fibulin 3 (FBLN3)", type "Antibodies"
Hosts Rabbit (28), Mouse (1)
Reactivities Human (22), Mouse (Murine) (9), Rat (Rattus) (9), Chicken (2), Cow (Bovine) (2), Dog (Canine) (2), Monkey (1), Zebrafish (1)
Applications Western Blotting (WB) (25), ELISA (13), Immunocytochemistry (ICC) (5), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Flow Cytometry (FACS) (3), Immunofluorescence (IF) (2), Immunoprecipitation (IP) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Biotin (2), FITC (1)
Epitopes Internal Region (4), C-Term (3), AA 258-493 (1), N-Term (1)