58K Golgi Protein antibody

Antigen: 58K Golgi Protein

Synonyms: LCHC1, wu:fp37b11, MGC64458, Ftcd, MGC63647, FTCD, ftcd, MGC89380

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN502143

Additional Information

Gene ID: FTCD

UniProt: O95954

Immunogen: The immunogen for anti-FTCD antibody: synthetic peptide directed towards the middle region of human FTCD

Sequence: KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKV QGIGWYLDEK

Cross-Reactivity: Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FTCD antibody concentration is 1 mg/ml.

Description: FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM].

Characteristics: Antigen Size: 549 amino acids

Molecular Weight: 59kDa

Application Details

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-58K Golgi Protein antibody

anti-58K Golgi Protein antibody (Image 2)

Publications

Product: Hillman, Green, Brenner: "An unappreciated role for RNA surveillance." in: Genome biology, Vol. 5, Issue 2, pp. R8, 2004 (PubMed).