Transmembrane Protein 2 (TMEM2) antibody

Antigen: Transmembrane Protein 2 (TMEM2)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502252

Additional Information

Alternative name: TMEM2

Gene ID: TMEM2

UniProt: Q9UHN6

Immunogen: The immunogen for anti-TMEM2 antibody: synthetic peptide directed towards the middle region of human TMEM2

Sequence: MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRG DPSVISVNGT

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM2 antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 1383 amino acids

Molecular Weight: 154kDa

Application Details

Application Notes: WB Suggested Anti-TMEM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate

Publications

Product: Scott, Drury, Sundstrom et al.: "Refining the DFNB7-DFNB11 deafness locus using intragenic polymorphisms in a novel gene, TMEM2." in: Gene, Vol. 246, Issue 1-2, pp. 265-74, 2000 (PubMed).