Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

TNF Receptor-Associated Factor 7 (TRAF7) antibody

Antigen

TNF Receptor-Associated Factor 7 (TRAF7)
Synonyms RFWD1, RNF119, MGC7807, DKFZp586I021, RGD1559653, rfwd1, MGC52680, MGC158391, im:7149067, zgc:158391
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502378
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-TNF Receptor-Associated Factor 7 (TRAF7) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name TRAF7 / RNF119
Gene ID TRAF7
UniProt Q6Q0C0
Immunogen The immunogen for anti-TRAF7 antibody: synthetic peptide directed towards the N terminal of human TRAF7
Sequence GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEE DSMPPISTPR
Cross-Reactivity Human, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TRAF7 antibody concentration is 1 mg/ml.
Description Tumor necrosis factor (TNF, see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc
Characteristics Antigen Size: 670 amino acids
Molecular Weight 74kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-TRAF7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Stomach.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Xu, Li, Shu: "TRAF7 potentiates MEKK3-induced AP1 and CHOP activation and induces apoptosis." in: The Journal of biological chemistry, Vol. 279, Issue 17, pp. 17278-82, 2004 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "TNF Receptor-Associated Factor 7 (TRAF7)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Mouse (Murine) (17), Rat (Rattus) (17)
Applications Immunofluorescence (IF) (14), ELISA (6), Western Blotting (WB) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes AA 334-356 (1), N-Term (1)