Polycomb Group Ring Finger 5 (PCGF5) antibody

Antigen: Polycomb Group Ring Finger 5 (PCGF5)

Synonyms: RNF159, MGC16202, AI324127, 0610009F02Rik, 1110054A01Rik, 5830406C17Rik, 5830443C21Rik, 9530023M17Rik, MGC142374, MGC189388, pcgf5, zgc:136815

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN502379

Additional Information

Alternative name: PCGF5 / RNF159

Gene ID: PCGF5

UniProt: Q86SE9

Immunogen: The immunogen for anti-PCGF5 antibody: synthetic peptide directed towards the N terminal of human PCGF5

Sequence: ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKT CIVQHFEDSN

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PCGF5 antibody concentration is 1 mg/ml.

Description: PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.

Characteristics: Antigen Size: 256 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-PCGF5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PCGF5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).