Tripartite Motif Containing 55 (TRIM55) antibody

Antigen: Tripartite Motif Containing 55 (TRIM55)

Synonyms: RNF29, MURF-2, trim55, zgc:92123, wu:fb71c01, TRIM55, MGC137179

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Zebrafish, Chicken, Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN502382

Additional Information

Alternative name: TRIM55 / MURF2 / RNF29

Gene ID: TRIM55

UniProt: B3KRC0

Immunogen: The immunogen for anti-TRIM55 antibody: synthetic peptide directed towards the N terminal of human TRIM55

Sequence: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQE STRPEKKSDQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRIM55 antibody concentration is 1 mg/ml.

Description: TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described.

Characteristics: Antigen Size: 452 amino acids

Molecular Weight: 51kDa

Application Details

Application Notes: WB Suggested Anti-TRIM55 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRIM55 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

Publications

Product: Lange, Xiang, Yakovenko et al.: "The kinase domain of titin controls muscle gene expression and protein turnover." in: Science (New York, N.Y.), Vol. 308, Issue 5728, pp. 1599-603, 2005 (PubMed).