Did you know that you can buy products from over 140 different suppliers from us?

Acid Phosphatase-Like 2 (ACPL2) (N-Term) antibody

Details for Product No. ABIN502568
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9430094M07Rik, BB177120, C130099A20Rik, zgc:92652, wu:fj34f09, ACPL2, ESP49.9, MGC146822
Epitope
N-Term
(8), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(26), (15), (15), (13), (12), (12)
Host
Rabbit
(28)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (13), (10), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502568
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ACPL2
Sequence PSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTK RPEIDCTLVA
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Horse : 90 %, Chicken : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against ACPL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ACPL2
Background The specific function of the protein remains unknown.
Molecular Weight 55 kDa
Gene ID 92370
NCBI Accession NM_001037172, NP_001032249
UniProt Q8TE99
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 480 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Acid Phosphatase-Like 2 (ACPL2) (N-Term) antibody WB Suggested Anti-ACPL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502568
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top