Protocadherin 1 (PCDH1) antibody

Antigen: Protocadherin 1 (PCDH1)

Synonyms: PC42, PCDH42, FLJ53887, MGC45991

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN502613

Additional Information

Alternative name: PCDH1

Gene ID: PCDH1

UniProt: Q08174

Immunogen: The immunogen for anti-PCDH1 antibody: synthetic peptide directed towards the N terminal of human PCDH1

Sequence: LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSL AADYGFPDVG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PCDH1 antibody concentration is 1 mg/ml.

Description: PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene.

Characteristics: Antigen Size: 1060 amino acids

Molecular Weight: 111kDa

Application Details

Application Notes: WB Suggested Anti-PCDH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-PCDH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

anti-Protocadherin 1 (PCDH1) antibody (Image 2)

Publications

Product: Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).