Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lamin B1 (LMNB1) antibody

Antigen

Lamin B1 (LMNB1)

Synonyms LMN, ADLD, LMN2, LMNB, MGC111419, fc06g01, wu:fc06g01, MGC52550, Lamin-L(I), lmn, lmn2, lmnb, LMNB1, MGC165937, LOC100037680
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502713
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Lamin-B1 (LMNB1)
Gene ID LMNB1
UniProt P20700
Immunogen The immunogen for anti-LMNB1 antibody: synthetic peptide directed towards the middle region of human LMNB1
Sequence EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTP RASNRSCAIM
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-LMNB1 antibody concentration is 1 mg/ml.
Description LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 586 amino acids
Molecular Weight 66kDa

Application Details

Application Notes WB Suggested Anti-LMNB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: SK-MEL-2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cytoskeleton
Restrictions For Research Use only

Publications

Product Lee, Seng, Sekine et al.: "Vascular endothelial growth factor mediates intracrine survival in human breast carcinoma cells through internally expressed VEGFR1/FLT1." in: PLoS medicine, Vol. 4, Issue 6, pp. e186, 2007 (PubMed).