PPPDE Peptidase Domain Containing 2 (PPPDE2) antibody

Antigen: PPPDE Peptidase Domain Containing 2 (PPPDE2)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502729

Additional Information

Alternative name: PPPDE2

Gene ID: D15Wsu75e

UniProt: Q6ICB0

Immunogen: The immunogen for anti-D15Wsu75e antibody: synthetic peptide directed towards the middle region of human D15Wsu75e

Sequence: FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPG GSSVGRPNGQ

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-D15Wsu75e antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 168 amino acids

Molecular Weight: 18kDa

Application Details

Application Notes: WB Suggested Anti-D15Wsu75e Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-D15Wsu75e Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).