Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502774

KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI173274, ERD2L3, ERD2, kdelr
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502774
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3
Sequence AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLEN YSFTLLEILW
Predicted Reactivity Bovine : 100%, Dog : 100%, Pig : 100%, Chicken : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against KDELR3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KDELR3
Background Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. KDELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to KDELR1 and KDELR2 proteins.Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. KDELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to KDELR1 and KDELR2 proteins. Two transcript variants of KDELR3 that arise by alternative splicing, and encode different isoforms of KDELR3 receptor, have been described.
Molecular Weight 25kDa
Gene ID 11015
NCBI Accession NP_006846, NM_006855
UniProt O43731
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KDELR3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3)", type "Antibodies"
Hosts (6)
Reactivities (5), (3)
Applications (6), (2), (2), (1)
Epitopes (2), (1)
Beacon