Formin-Like 2 (FMNL2) antibody

Antigen: Formin-Like 2 (FMNL2)

Synonyms: Man, 5430425K04Rik, FHOD2, FLJ37546, FMNL2, si:ch211-279a7.1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN502886

Additional Information

Alternative name: Formin-like protein 2

Gene ID: FMNL2

UniProt: Q96PY5

Immunogen: The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2

Sequence: MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLN AMNLPPDKAR

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FMNL2 antibody concentration is 1 mg/ml.

Description: FMNL2 is a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has yet to be determined.

Characteristics: Antigen Size: 1092 amino acids

Molecular Weight: 124kDa

Application Details

Application Notes: WB Suggested Anti-FMNL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FMNL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).