SCAN Domain Containing 3 (SCAND3) antibody

Antigen: SCAN Domain Containing 3 (SCAND3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502887

Additional Information

Alternative name: SCAND3

Gene ID: SCAND3

UniProt: Q6R2W3

Immunogen: The immunogen for anti-SCAND3 antibody: synthetic peptide directed towards the C terminal of human SCAND3

Sequence: ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTS KKQAHLSH

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SCAND3 antibody concentration is 1 mg/ml.

Description: The function of SCAND3 has not yet been determined.

Characteristics: Antigen Size: 1325 amino acids

Molecular Weight: 152kDa

Application Details

Application Notes: WB Suggested Anti-SCAND3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SCAND3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).