T-Box 15 (TBX15) antibody

Antigen: T-Box 15 (TBX15)

Synonyms: TBX14, de, Tbx8, Tbx14, MGC63576, MGC158205, zgc:63576, zgc:158205, TBX15

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN502892

Additional Information

Alternative name: TBX15

Gene ID: TBX15

UniProt: Q96SF7

Immunogen: The immunogen for anti-TBX15 antibody: synthetic peptide directed towards the C terminal of human TBX15

Sequence: SSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLL CSSPSNGAFG

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TBX15 antibody concentration is 1 mg/ml.

Description: TBX15 is a probable transcriptional regulator involved in developmental processes.

Characteristics: Antigen Size: 496 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-TBX15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TBX15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).