Lipase, Gastric (LIPF) antibody

Antigen: Lipase, Gastric (LIPF)

Synonyms: GL, HGL, HLAL, MGC138477, MGC142271, Rnlp, RNLIP, AV082900, 2310051B21Rik, LIPF, DGL, fb73g06, zgc:56632, wu:fb73g06

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN502921

Additional Information

Alternative name: Gastric lipase

Gene ID: LIPF

UniProt: P07098

Immunogen: The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF

Sequence: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNT GQRPVVFLQH

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LIPF antibody concentration is 1 mg/ml.

Description: The specific functin of this protein remains unknown.This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 398 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-LIPF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-LIPF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).