Aldolase C, Fructose-Bisphosphate (ALDOC) antibody

Antigen: Aldolase C, Fructose-Bisphosphate (ALDOC)

Synonyms: ALDC, aldoc, MGC52977, MGC69434, ALDOC

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN502924

Additional Information

Alternative name: Aldolase C / ALDOC

Gene ID: ALDOC

UniProt: P09972

Immunogen: The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the C terminal of human ALDOC

Sequence: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFI KRAEVNGLAA

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ALDOC antibody concentration is 1 mg/ml.

Description: ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Characteristics: Antigen Size: 364 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Enzymes

Restrictions: For Research Use only

Images

WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Publications

Product: Kim, Sprung, Chen et al.: "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." in: Molecular cell, Vol. 23, Issue 4, pp. 607-18, 2006 (PubMed).