NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4) antibody

Antigen: NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503025

Additional Information

Alternative name: NSUN4

Gene ID: NSUN4

UniProt: Q96CB9

Immunogen: The immunogen for anti-NSUN4 antibody: synthetic peptide directed towards the N terminal of human NSUN4

Sequence: QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQS EGGQSAAPSP

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NSUN4 antibody concentration is 1 mg/ml.

Description: NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity

Characteristics: Antigen Size: 384 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-NSUN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NSUN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).