AT Rich Interactive Domain 5A (MRF1-Like) (ARID5A) antibody

Antigen: AT Rich Interactive Domain 5A (MRF1-Like) (ARID5A)

Synonyms: MGC124686, MGC129026, MRF1, MRF-1, RP11-363D14, Mrf1, MGC36895, D430024K22Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503241

Additional Information

Alternative name: ARID5A / MRF1

Gene ID: ARID5A

UniProt: Q03989

Immunogen: The immunogen for anti-ARID5A antibody: synthetic peptide directed towards the N terminal of human ARID5A

Sequence: MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLE DSPEAGGERE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ARID5A antibody concentration is 1 mg/ml.

Description: Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth. Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]).[supplied by OMIM].

Characteristics: Antigen Size: 594 amino acids

Molecular Weight: 64kDa

Application Details

Application Notes: WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate

Publications

Product: Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).