Lysophospholipase I (LYPLA1) antibody

Antigen: Lysophospholipase I (LYPLA1)

Synonyms: LPL1, APT-1, LYSOPLA

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Rabbit, Zebrafish, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN503315

Additional Information

Alternative name: LYPLA1

Gene ID: LYPLA1

UniProt: O75608

Immunogen: The immunogen for anti-LYPLA1 antibody: synthetic peptide directed towards the middle region of human LYPLA1

Sequence: SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPS NRIILGGFSQ

Cross-Reactivity: Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LYPLA1 antibody concentration is 1 mg/ml.

Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Characteristics: Antigen Size: 230 amino acids

Molecular Weight: 25kDa

Application Details

Application Notes: WB Suggested Anti-LYPLA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: CCRF-CEM cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-LYPLA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: CCRF-CEM cell lysate

Publications

Product: Devedjiev, Dauter, Kuznetsov et al.: "Crystal structure of the human acyl protein thioesterase I from a single X-ray data set to 1.5 A." in: Structure (London, England : 1993), Vol. 8, Issue 11, pp. 1137-46, 2000 (PubMed).