WAP Four-Disulfide Core Domain 5 (WFDC5) antibody

Antigen: WAP Four-Disulfide Core Domain 5 (WFDC5)

Synonyms: PRG5, WAP1, dJ211D12.5, Prg5, Wap1, BC019734

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503392

Additional Information

Alternative name: WFDC5 / WAP1

Gene ID: WFDC5

Immunogen: The immunogen for anti-WFDC5 antibody: synthetic peptide directed towards the N terminal of human WFDC5

Sequence: MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGP CLLSVPDQCV

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WFDC5 antibody concentration is 1 mg/ml.

Description: WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

Characteristics: Antigen Size: 123 amino acids

Molecular Weight: 11kDa

Application Details

Application Notes: WB Suggested Anti-WFDC5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WFDC5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Publications

Product: Mukhopadhyay, Rosen: "The C-terminal domain of the nuclear factor I-B2 isoform is glycosylated and transactivates the WAP gene in the JEG-3 cells." in: Biochemical and biophysical research communications, Vol. 358, Issue 3, pp. 770-6, 2007 (PubMed).