Tigger Transposable Element Derived 1 (TIGD1) antibody

Antigen: Tigger Transposable Element Derived 1 (TIGD1)

Synonyms: EEYORE

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503393

Additional Information

Alternative name: TIGD1

Gene ID: TIGD1

UniProt: Q96MW7

Immunogen: The immunogen for anti-TIGD1 antibody: synthetic peptide directed towards the middle region of human TIGD1

Sequence: SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDP PPAKRVRLTE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TIGD1 antibody concentration is 1 mg/ml.

Description: TIGD1 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this protein is not known.The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

Characteristics: Antigen Size: 591 amino acids

Molecular Weight: 67kDa

Application Details

Application Notes: WB Suggested Anti-TIGD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-TIGD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).