Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Coiled-Coil Domain Containing 63 (CCDC63) antibody

Antigen

Coiled-Coil Domain Containing 63 (CCDC63)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503421
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CCDC63
Gene ID CCDC63
UniProt Q8NA47
Immunogen The immunogen for anti-CCDC63 antibody: synthetic peptide directed towards the middle region of human CCDC63
Sequence IEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEII LLRSQQKLSH
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CCDC63 antibody concentration is 1 mg/ml.
Description The specific function of this protein remains unknown.
Characteristics Antigen Size: 563 amino acids
Molecular Weight 66kDa

Application Details

Application Notes WB Suggested Anti-CCDC63 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives

Alternatives for antigen "Coiled-Coil Domain Containing 63 (CCDC63)", type "Antibodies"
Hosts Rabbit (24)
Reactivities Human (22), Mouse (Murine) (18), Rat (Rattus) (18), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (9), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (2), C-Term (1)