RWD Domain Containing 4 (RWDD4) antibody

Antigen: RWD Domain Containing 4 (RWDD4)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN503430

Additional Information

Alternative name: RWDD4 / RWDD4A

Gene ID: RWDD4A

UniProt: Q6NW29

Immunogen: The immunogen for anti-RWDD4A antibody: synthetic peptide directed towards the middle region of human RWDD4A

Sequence: SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVK HLSKTGSKDD

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RWDD4A antibody concentration is 1 mg/ml.

Description: The specific function of this protein remains unknown.

Characteristics: Antigen Size: 188 amino acids

Molecular Weight: 21kDa

Application Details

Application Notes: WB Suggested Anti-RWDD4A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SH-SYSY cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RWDD4A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SH-SYSY cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).