Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503471

Abhydrolase Domain Containing 15 (ABHD15) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300007F04Rik, RGD1304598
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503471
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ABHD15 antibody: synthetic peptide directed towards the middle region of human LOC116236
Sequence LLALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEA VTYIRFRHPA
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Mouse : 100%, Pig : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against LOC116236. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ABHD15
Background The specific function of this protein remains unknown.
Molecular Weight 52kDa
Gene ID 116236
NCBI Accession NP_937790, NM_198147
UniProt Q6UXT9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ABHD15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Abhydrolase Domain Containing 15 (ABHD15)", type "Antibodies"
Hosts (6)
Reactivities (6), (4), (2), (2)
Applications (6), (2)
Epitopes (2), (1), (1)
Beacon