Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Abhydrolase Domain Containing 15 (ABHD15) antibody

Antigen

Abhydrolase Domain Containing 15 (ABHD15)

Synonyms 1300007F04Rik, RGD1304598
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503471
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ABHD15
Gene ID ABHD15
UniProt Q6UXT9
Immunogen The immunogen for anti-ABHD15 antibody: synthetic peptide directed towards the middle region of human LOC116236
Sequence LLALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEA VTYIRFRHPA
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ABHD15 antibody concentration is 1 mg/ml.
Description The specific function of this protein remains unknown.
Characteristics Antigen Size: 468 amino acids
Molecular Weight 52kDa

Application Details

Application Notes WB Suggested Anti-ABHD15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives

Alternatives for antigen "Abhydrolase Domain Containing 15 (ABHD15)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (22), Mouse (Murine) (20), Rat (Rattus) (19), Cow (Bovine) (2)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (5), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (1), N-Term (1)