Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Alpha Tubulin / TUBA3C / TUBA2 antibody

Antigen

Alpha Tubulin / TUBA3C / TUBA2

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus), Arabidopsis

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503489
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Gene ID TUBA3C
UniProt Q13748
Immunogen The immunogen for anti-TUBA3C antibody: synthetic peptide directed towards the N terminal of human TUBA3C
Sequence QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTV VDEVRTGTYR
Cross-Reactivity Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TUBA3C antibody concentration is 1 mg/ml.
Description Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 450 amino acids
Molecular Weight 50kDa

Application Details

Application Notes WB Suggested Anti-TUBA3C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).

Alternatives

Alternatives for antigen "Alpha Tubulin / TUBA3C / TUBA2", type "Antibodies"
Hosts Rabbit (1)
Reactivities Caenorhabditis elegans (C. elegans) (1), Fruit Fly (Drosophila melanogaster) (1), Human (1), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (1)