Did you know that you can buy products from over 140 different suppliers from us?

Apolipoprotein E (APOE) (N-Term) antibody

Details for Product No. ABIN503507
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ad2, apoprotein, im:7036787, wu:fb69a05, zgc:110064, apoe, AI255918, AD2, LDLCQ5, LPG, APOEA, Apo-E
Epitope
N-Term
(16), (5), (4), (4), (3), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(175), (40), (31), (4), (3), (1)
Host
Rabbit
(100), (65), (46)
Clonality
Polyclonal
Conjugate
Un-conjugated
(12), (7), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(150), (119), (42), (41), (20), (20), (14), (11), (8), (8), (8), (7), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503507
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human APOE
Sequence KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSG QRWELALGRF
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against APOE. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name APOE
Background Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Molecular Weight 34 kDa
Gene ID 348
NCBI Accession NM_000041, NP_000032
UniProt P02649
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 317 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Apolipoprotein E (APOE) (N-Term) antibody anti-Apolipoprotein E (APOE) (N-Term) antibody
anti-Apolipoprotein E (APOE) (N-Term) antibody (2) anti-Apolipoprotein E (APOE) (N-Term) antibody (Image 2)
anti-Apolipoprotein E (APOE) (N-Term) antibody (3) anti-Apolipoprotein E (APOE) (N-Term) antibody (Image 3)
Background publications Ho, Niti, Yap et al.: "Metabolic syndrome and cognitive decline in chinese older adults: results from the singapore longitudinal ageing studies." in: The American journal of geriatric psychiatry : official journal of the American Association for Geriatric Psychiatry, Vol. 16, Issue 6, pp. 519-22, 2008 (PubMed).

Validation Images
back to top