Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503507

Apolipoprotein E (APOE) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AD2, LDLCQ5, LPG, AI255918, APOEA, Apo-E, ad2, apoprotein, im:7036787, wu:fb69a05, zgc:110064, apoe
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN503507
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-APOE antibody: synthetic peptide directed towards the N terminal of human APOE
Sequence KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSG QRWELALGRF
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against APOE. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name APOE
Background Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Molecular Weight 34kDa
Gene ID 348
NCBI Accession NP_000032, NM_000041
UniProt P02649
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-APOE antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ho, Niti, Yap et al.: "Metabolic syndrome and cognitive decline in chinese older adults: results from the singapore longitudinal ageing studies." in: The American journal of geriatric psychiatry : official journal of the American Association for Geriatric Psychiatry, Vol. 16, Issue 6, pp. 519-22, 2008 (PubMed).

Alternatives for antigen "Apolipoprotein E (APOE)", type "Antibodies"
Hosts (97), (70), (50)
Reactivities (175), (41), (33), (5), (4), (1)
Applications (155), (130), (52), (35), (20), (17), (12), (11), (9), (8), (7), (7), (5), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Conjugates (13), (8), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Epitopes (12), (4), (4), (3), (2), (1), (1), (1)
Beacon