Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Apolipoprotein E (APOE) antibody

Antigen

Apolipoprotein E (APOE)

Synonyms AD2, LPG, LDLCQ5, MGC1571, AI255918, APOEA, APOE, ad2, apoprotein, MGC110064, im:7036787, wu:fb69a05, zgc:110064, apoe
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN503507
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Apolipoprotein E (Apo E)
Gene ID APOE
UniProt P02649
Immunogen The immunogen for anti-APOE antibody: synthetic peptide directed towards the N terminal of human APOE
Sequence KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSG QRWELALGRF
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-APOE antibody concentration is 1 mg/ml.
Description Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 317 amino acids
Molecular Weight 34kDa

Application Details

Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Metabolism
Restrictions For Research Use only

Publications

Product Ho, Niti, Yap et al.: "Metabolic syndrome and cognitive decline in chinese older adults: results from the singapore longitudinal ageing studies." in: The American journal of geriatric psychiatry : official journal of the American Association for Geriatric Psychiatry, Vol. 16, Issue 6, pp. 519-22, 2008 (PubMed).