WW Domain Binding Protein 2 (WBP2) antibody

Antigen: WW Domain Binding Protein 2 (WBP2)

Synonyms: WBP-2, MGC18269, zgc:64061, wu:fc64g04, MGC68743, wbp-2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503601

Additional Information

Alternative name: WBP2

Gene ID: WBP2

UniProt: Q969T9

Immunogen: The immunogen for anti-WBP2 antibody: synthetic peptide directed towards the N terminal of human WBP2

Sequence: MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPF YLMKDCEIKQ

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WBP2 antibody concentration is 1 mg/ml.

Description: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

Characteristics: Antigen Size: 261 amino acids

Molecular Weight: 28kDa

Application Details

Application Notes: WB Suggested Anti-WBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus

Publications

Product: Dhananjayan, Ramamoorthy, Khan et al.: "WW domain binding protein-2, an E6-associated protein interacting protein, acts as a coactivator of estrogen and progesterone receptors." in: Molecular endocrinology (Baltimore, Md.), Vol. 20, Issue 10, pp. 2343-54, 2006 (PubMed).