Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 17 Open Reading Frame78 (C17orf78) antibody

Antigen

Chromosome 17 Open Reading Frame78 (C17orf78)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503729
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C17orf78
Gene ID C17orf78
UniProt Q8N4C9
Immunogen The immunogen for anti-C17orf78 antibody: synthetic peptide directed towards the middle region of human C17orf78
Sequence LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQD AANSSNPKKA
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C17orf78 antibody concentration is 1 mg/ml.
Description The exact function of the protein encoded by this gene is not known.
Characteristics Antigen Size: 275 amino acids
Molecular Weight 30kDa

Application Details

Application Notes WB Suggested Anti-C17orf78 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 17 Open Reading Frame78 (C17orf78)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1)