Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

PDZ Domain Containing 9 (PDZD9) antibody

Antigen

PDZ Domain Containing 9 (PDZD9)

Synonyms LRRGT00105
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503738
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C16orf65
Gene ID C16orf65
Immunogen The immunogen for anti-C16orf65 antibody: synthetic peptide directed towards the middle region of human C16orf65
Sequence TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTV HHPARRPISI
Cross-Reactivity Dog (Canine), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C16orf65 antibody concentration is 1 mg/ml.
Description The specific function of the protein remains unknown.
Characteristics Antigen Size: 202 amino acids
Molecular Weight 23kDa

Application Details

Application Notes WB Suggested Anti-C16orf65 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Small Intestine.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Alternatives

Alternatives for antigen "PDZ Domain Containing 9 (PDZD9)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Internal Region (1)