Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Dpy-19-Like 4 (C. Elegans) (DPY19L4) antibody

Antigen

Dpy-19-Like 4 (C. Elegans) (DPY19L4)
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Rat (Rattus), Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503759
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Dpy-19-Like 4 (C. Elegans) (DPY19L4) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name DPY19L4
Gene ID DPY19L4
UniProt Q7Z388
Immunogen The immunogen for anti-DPY19L4 antibody: synthetic peptide directed towards the middle region of human DPY19L4
Sequence APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRN ENIYQIYSKR
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-DPY19L4 antibody concentration is 1 mg/ml.
Description The specific function of the protein remains unknown.
Characteristics Antigen Size: 723 amino acids
Molecular Weight 84kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-DPY19L4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Dpy-19-Like 4 (C. Elegans) (DPY19L4)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Internal Region (1)