Ribosomal Protein L37a (RPL37A) antibody

Antigen: Ribosomal Protein L37a (RPL37A)

Synonyms: MGC74786

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503855

Additional Information

Alternative name: RPL37A

Gene ID: RPL37A

UniProt: P61513

Immunogen: The immunogen for anti-RPL37A antibody: synthetic peptide directed towards the middle region of human RPL37A

Sequence: CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKS AIRRLKELKD

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RPL37A antibody concentration is 1 mg/ml.

Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

Characteristics: Antigen Size: 92 amino acids

Molecular Weight: 10kDa

Application Details

Application Notes: WB Suggested Anti-RPL37A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RPL37A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).