AKT Interacting Protein (AKTIP) antibody

Antigen: AKT Interacting Protein (AKTIP)

Synonyms: FT1, FTS, fts, cb798, zgc:77699, fts-A, aktip-A, MGC80257, MGC115456, fts-B, aktip-b, MGC133931

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN503874

Additional Information

Alternative name: AKTIP / FTS

Gene ID: AKTIP

UniProt: Q9H8T0

Immunogen: The immunogen for anti-AKTIP antibody: synthetic peptide directed towards the middle region of human AKTIP

Sequence: NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQ PFSKEEKTVA

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-AKTIP antibody concentration is 1 mg/ml.

Description: AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.The mouse homolog of this gene produces fused toes and thymic hyperplasia in heterozygous mutant animals while homozygous mutants die in early development. This gene may play a role in apoptosis as these morphological abnormalities are caused by altered patterns of programmed cell death. The protein encoded by this gene is similar to the ubiquitin ligase domain of other ubiquitin-conjugating enzymes but lacks the conserved cysteine residue that enables those enzymes to conjugate ubiquitin to the target protein. This protein interacts directly with serine/threonine kinase protein kinase B (PKB)/Akt and modulates PKB activity by enhancing the phosphorylation of PKB's regulatory sites. Alternative splicing results in two transcript variants encoding the same protein.

Characteristics: Antigen Size: 292 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-AKTIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-AKTIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).