Chromosome 9 Open Reading Frame 68 (C9orf68) antibody

Antigen: Chromosome 9 Open Reading Frame 68 (C9orf68)

Synonyms: FLJ10058, bA6J24.2, RP11-280I16.2, MGC131199, MGC146453

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503899

Additional Information

Alternative name: C9orf68

Gene ID: C9orf68

UniProt: Q8N4H0

Immunogen: The immunogen for anti-C9orf68 antibody: synthetic peptide directed towards the middle region of human C9orf68

Sequence: CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQ PLLRERFHPG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C9orf68 antibody concentration is 1 mg/ml.

Description: The specific function of this protein remains unknown.

Characteristics: Antigen Size: 392 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-C9orf68 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C9orf68 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Publications

Product: Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).