PRKY antibody

Antigen: PRKY

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503969

Additional Information

Gene ID: PRKY

Immunogen: The immunogen for anti-PRKY antibody: synthetic peptide directed towards the N terminal of human PRKY

Sequence: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPE APAYRLQDCD

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PRKY antibody concentration is 1 mg/ml.

Description: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense

Characteristics: Antigen Size: 277 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-PRKY Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PRKY Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Publications

Product: Skaletsky, Kuroda-Kawaguchi, Minx et al.: "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes." in: Nature, Vol. 423, Issue 6942, pp. 825-37, 2003 (PubMed).