Ran GTPase Activating Protein 1 (RANGAP1) antibody

Antigen: Ran GTPase Activating Protein 1 (RANGAP1)

Synonyms: SD, Fug1, KIAA1835, MGC20266, RAN GTPASE ACTIVATING PROTEIN 1, RANGAP1, fug1, rna1p, RanGAP1, rangap1b, MGC154793

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503988

Additional Information

Alternative name: RanGAP1

Gene ID: RANGAP1

UniProt: P46060

Immunogen: The immunogen for anti-RANGAP1 antibody: synthetic peptide directed towards the N terminal of human RANGAP1

Sequence: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKD VIKEIEDFDS

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RANGAP1 antibody concentration is 1 mg/ml.

Description: RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGA

Characteristics: Antigen Size: 587 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-RANGAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-RANGAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).