Mitochondrial Ribosomal Protein L48 (MRPL48) antibody

Antigen: Mitochondrial Ribosomal Protein L48 (MRPL48)

Synonyms: L48MT, CGI-118, HSPC290, MRP-L48, FLJ17047, FLJ99260, MGC13323

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504093

Additional Information

Alternative name: MRPL48

Gene ID: MRPL48

UniProt: Q96GC5

Immunogen: The immunogen for anti-MRPL48 antibody: synthetic peptide directed towards the middle region of human MRPL48

Sequence: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYV HNLCNSLSIK

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MRPL48 antibody concentration is 1 mg/ml.

Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Characteristics: Antigen Size: 212 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-MRPL48 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-MRPL48 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).