Trafficking Protein Particle Complex 4 (TRAPPC4) antibody
| Antigen | Trafficking Protein Particle Complex 4 (TRAPPC4) |
| Synonyms | SBDN, TRS23, PTD009, CGI-104, HSPC172, SYNBINDIN, Sbd, Sbdn, Sdcbp2, AI303617, 1500017G03Rik, MGC73260, zgc:73260, TRAPPC4, MGC134224, MGC131237, sbdn, trs23, ptd009, cgi-104, hspc172, DKFZp459H1242 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Human, Mouse (Murine), Rat (Rattus) |
| Application |
Alternatives Western Blotting (WB) |
 |
1 reference available |
| Catalog no. | ABIN504099 |
| Quantity | 50 µg |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | TRAPPC4 |
| Gene ID | TRAPPC4 |
| UniProt | Q9Y296 |
| Immunogen | The immunogen for anti-TRAPPC4 antibody: synthetic peptide directed towards the middle region of human TRAPPC4 |
| Sequence | EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHC YQTLTGIKFV |
| Cross-Reactivity | Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-TRAPPC4 antibody concentration is 1 mg/ml. |
| Description | TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi. |
| Characteristics | Antigen Size: 219 amino acids |
| Molecular Weight | 24kDa |
Application Details
| Application Notes |
WB Suggested Anti-TRAPPC4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Signaling |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-TRAPPC4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart |
Publications
| Product |
Gavin, Bösche, Krause et al.: "Functional organization of the yeast proteome by systematic analysis of protein complexes." in: Nature, Vol. 415, Issue 6868, pp. 141-7, 2002 (PubMed).
|
Alternatives
Alternatives for antigen "Trafficking Protein Particle Complex 4 (TRAPPC4)", type "Antibodies"
| Hosts | Rabbit (11), Mouse (7) |
| Reactivities | Human (16), Mouse (Murine) (3), Rat (Rattus) (3) |
| Applications | Western Blotting (WB) (17), ELISA (10), Flow Cytometry (FACS) (3), Immunofluorescence (IF) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (2) |
| Epitopes | N-Term (3), Internal Region (1) |
