TRAPPC2L antibody

Antigen: TRAPPC2L

Synonyms: HSPC176, FLJ44827, MGC111156, MGC166180, DKFZp469K0715, TRAPPC2L

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504103

Additional Information

Gene ID: TRAPPC2L

UniProt: Q9UL33

Immunogen: The immunogen for anti-TRAPPC2L antibody: synthetic peptide directed towards the N terminal of human TRAPPC2L

Sequence: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVD EKISAMGKAL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRAPPC2L antibody concentration is 1 mg/ml.

Description: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Characteristics: Antigen Size: 140 amino acids

Molecular Weight: 16kDa

Application Details

Application Notes: WB Suggested Anti-TRAPPC2L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRAPPC2L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).