Vacuolar Protein Sorting 29 Homolog (S. Cerevisiae) (VPS29) antibody

Antigen: Vacuolar Protein Sorting 29 Homolog (S. Cerevisiae) (VPS29)

Synonyms: VPS29, fb06g05, MGC56191, MGC86638, zgc:56191, zgc:86638, wu:fb06g05, PEP11, VPT6, DC7, DC15, FLJ20492, DKFZp564F0223, AW049835, 2010015D08Rik, MGC127483, vps29, ATVPS29, MAG1, MAIGO 1, VACUOLAR PROTEIN SORTING 29, 17.m07782

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN504106

Additional Information

Alternative name: VPS29

Gene ID: VPS29

UniProt: Q9UBQ0

Immunogen: The immunogen for anti-VPS29 antibody: synthetic peptide directed towards the N terminal of human VPS29

Sequence: LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKV VTVGQFKIGL

Cross-Reactivity: Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-VPS29 antibody concentration is 1 mg/ml.

Description: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome

Characteristics: Antigen Size: 182 amino acids

Molecular Weight: 20kDa

Synonyms: VPS29, fb06g05, MGC56191, MGC86638, zgc:56191, zgc:86638, wu:fb06g05, PEP11, VPT6, DC7, DC15, FLJ20492, DKFZp564F0223, AW049835, 2010015D08Rik, MGC127483, vps29, ATVPS29, MAG1, MAIGO 1, VACUOLAR PROTEIN SORTING 29, 17.m07782

Application Details

Application Notes: WB Suggested Anti-VPS29 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-VPS29 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysate

Publications

Product: Hierro, Rojas, Rojas et al.: "Functional architecture of the retromer cargo-recognition complex." in: Nature, Vol. 449, Issue 7165, pp. 1063-7, 2007 (PubMed).