Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Calcium Binding Protein 39 (CAB39) antibody

Antigen

Calcium Binding Protein 39 (CAB39)

Synonyms MO25, CGI-66, FLJ22682, C78372, AA408805, AA960512, fc06a03, zgc:86716, wu:fc06a03, MGC78903, CAB39, MGC137705
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504114
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CAB39
Gene ID CAB39
UniProt Q9Y376
Immunogen The immunogen for anti-CAB39 antibody: synthetic peptide directed towards the middle region of human CAB39
Sequence KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYL VKQIRDLKRP
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CAB39 antibody concentration is 1 mg/ml.
Description Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.
Characteristics Antigen Size: 341 amino acids
Molecular Weight 40kDa

Application Details

Application Notes WB Suggested Anti-CAB39 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer
Restrictions For Research Use only

Publications

Product Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives

Alternatives for antigen "Calcium Binding Protein 39 (CAB39)", type "Antibodies"
Hosts Rabbit (16), Mouse (4)
Reactivities Human (15), Mouse (Murine) (3), Rat (Rattus) (1)
Applications Western Blotting (WB) (17), ELISA (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Flow Cytometry (FACS) (3), Immunohistochemistry (IHC) (3), Immunocytochemistry (ICC) (1), Immunoprecipitation (IP) (1)
Conjugates Biotin (1), FITC (1)
Epitopes C-Term (3), N-Term (3), Internal Region (1)