RAS-Like, Family 12 (RASL12) antibody

Antigen: RAS-Like, Family 12 (RASL12)

Synonyms: RIS, 4631404I11Rik, MGC139757

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504130

Additional Information

Alternative name: RASL12 / RIS

Gene ID: RASL12

UniProt: Q9NYN1

Immunogen: The immunogen for anti-RASL12 antibody: synthetic peptide directed towards the N terminal of human RASL12

Sequence: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKF LTKRFISEYD

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RASL12 antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 266 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-RASL12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RASL12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Publications

Product: Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).