Proline Rich 16 (PRR16) antibody

Antigen: Proline Rich 16 (PRR16)

Synonyms: DSC54, MGC104614

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504132

Additional Information

Alternative name: Proline-rich protein 16 / PRR16

Gene ID: PRR16

UniProt: Q569H4-3

Immunogen: The immunogen for anti-PRR16 antibody: synthetic peptide directed towards the middle region of human PRR16

Sequence: RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPP GKIPHQGPPL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PRR16 antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 281 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-PRR16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PRR16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine

Publications

Product: Barberi, Willis, Socci et al.: "Derivation of multipotent mesenchymal precursors from human embryonic stem cells." in: PLoS medicine, Vol. 2, Issue 6, pp. e161, 2005 (PubMed).