Microfibrillar Associated Protein 2 (MFAP2) antibody

Antigen: Microfibrillar Associated Protein 2 (MFAP2)

Synonyms: MAGP, MAGP1, MAGP-1, FLJ50901, DKFZp586F0219

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504134

Additional Information

Alternative name: MFAP2

Gene ID: MFAP2

UniProt: P55001

Immunogen: The immunogen for anti-MFAP2 antibody: synthetic peptide directed towards the N terminal of human MFAP2

Sequence: MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSD QIDNPDYYDY

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MFAP2 antibody concentration is 1 mg/ml.

Description: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for

Characteristics: Antigen Size: 183 amino acids

Molecular Weight: 19kDa

Application Details

Application Notes: WB Suggested Anti-MFAP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MFAP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver

Publications

Product: Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).