Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 2 Open Reading Frame 29 (C2orf29) antibody

Antigen

Chromosome 2 Open Reading Frame 29 (C2orf29)

Synonyms C40
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504139
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C2orf29
Gene ID C2orf29
UniProt Q9UKZ1
Immunogen The immunogen for anti-C2orf29 antibody: synthetic peptide directed towards the middle region of human C2orf29
Sequence SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNS GFDSSVASQI
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C2orf29 antibody concentration is 1 mg/ml.
Description The function of this protein remains unknown.
Characteristics Antigen Size: 510 amino acids
Molecular Weight 55kDa

Application Details

Application Notes WB Suggested Anti-C2orf29 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 2 Open Reading Frame 29 (C2orf29)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1), N-Term (1)