Vacuolar Protein Sorting 37 Homolog C (S. Cerevisiae) (VPS37C) antibody

Antigen: Vacuolar Protein Sorting 37 Homolog C (S. Cerevisiae) (VPS37C)

Synonyms: FLJ20847, AU042646, 5730409F24Rik, RGD1309258, DKFZp468H155

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504168

Additional Information

Alternative name: VPS37C

Gene ID: VPS37C

UniProt: A5D8V6

Immunogen: The immunogen for anti-VPS37C antibody: synthetic peptide directed towards the N terminal of human VPS37C

Sequence: LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQEL RKLVERCQEQ

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-VPS37C antibody concentration is 1 mg/ml.

Description: VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies

Characteristics: Antigen Size: 355 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-VPS37C Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-VPS37C Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Publications

Product: Eastman, Martin-Serrano, Chung et al.: "Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding." in: The Journal of biological chemistry, Vol. 280, Issue 1, pp. 628-36, 2004 (PubMed).